General Information

  • ID:  hor003266
  • Uniprot ID:  Q60478
  • Protein name:  Leu-Enkephalin
  • Gene name:  PDYN
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Opioid neuropeptide precursor family
  • Source:  animal
  • Expression:  brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0005886 plasma membrane; GO:0098686 hippocampal mossy fiber to CA3 synapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  YGGFL
  • Length:  5(164-168)
  • Propeptide:  MVWPRLVLAACLLAMPPAAAECLSQCSLCAVRTQDGPKPINPLICSLECQETLLPSEEWERCQGILSFFPSALRLRDQSGLDSRAALEEVYGELAKRARPFLQELEKSRFLPSTPAEDKFRGLLGGLGEGLGSEAMGAPQLNSGAVEAAALDFDEDPKEQVKRYGGFLRKYPKRSSEVAREGDRDGDNAGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSEEFFDV
  • Signal peptide:  MVWPRLVLAACLLAMPPAAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 21.2卤1.1 minute; /1272 seconds ( PubMed ID: 12444298 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q60478-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003266_AF2.pdbhor003266_ESM.pdb

Physical Information

Mass: 62716 Formula: C28H37N5O7
Absent amino acids: ACDEHIKMNPQRSTVW Common amino acids: G
pI: 6.09 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: 90 Boman Index: 964
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 78
Instability Index: 1570 Extinction Coefficient cystines: 1490
Absorbance 280nm: 372.5

Literature

  • PubMed ID:  8985124####12444298
  • Title:  Guinea Pig Preprodynorphin mRNA: Primary Structure and Regional Quantitation in the Brain